PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013623663.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 273aa    MW: 31420.2 Da    PI: 9.5321
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013623663.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.72.7e-182168148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+eEd +l d+++ +G g+W++ +r+ g+ Rt+k+c++rw++yl
   XP_013623663.1 21 RGPWTAEEDFKLTDYIATHGEGRWNSLSRCAGLQRTGKSCRLRWLNYL 68
                     89********************************************97 PP

2Myb_DNA-binding52.51.1e-1674117146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T eE++l+++++ q+G++ W++Ia++++ gRt++++k++w++
   XP_013623663.1  74 RGNITLEEQLLILELHSQWGNR-WSKIAQYLP-GRTDNEIKNYWRT 117
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.5461668IPR017930Myb domain
SuperFamilySSF466891.68E-3118115IPR009057Homeodomain-like
SMARTSM007171.7E-142070IPR001005SANT/Myb domain
PfamPF002499.3E-162168IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.1E-232275IPR009057Homeodomain-like
CDDcd001673.42E-112368No hitNo description
PROSITE profilePS5129423.27369123IPR017930Myb domain
SMARTSM007171.0E-1473121IPR001005SANT/Myb domain
PfamPF002495.0E-1574117IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.8E-2376122IPR009057Homeodomain-like
CDDcd001676.09E-789117No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MDEKGRSFKK NNMEDEMDLK RGPWTAEEDF KLTDYIATHG EGRWNSLSRC AGLQRTGKSC  60
RLRWLNYLRP DVRRGNITLE EQLLILELHS QWGNRWSKIA QYLPGRTDNE IKNYWRTRVQ  120
KHAKQLKCDV NSQQFKDTMK YMWMPRLVER IQSASASAAS LISTTGSATT SSCITTSNNE  180
FMTYDYNNNN SIGERLGVMN NNNYITPENS SVAVSPVSDL TDYYNAPKPN PDQNLRVYGT  240
LEKVMKTSGF VSSNNSSTII TTSEYRLKQT RVF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-25181214106B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF7382860.0KF738286.1 Brassica napus MYB transcription factor 108-1 (MYB108-1.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013623663.10.0PREDICTED: transcription factor MYB108-like isoform X2
SwissprotQ9LDE11e-124MY108_ARATH; Transcription factor MYB108
TrEMBLA0A0D3B9Z91e-177A0A0D3B9Z9_BRAOL; Uncharacterized protein
STRINGBra001202.1-P1e-148(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G06490.11e-117myb domain protein 108